PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo9G0038800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 250aa    MW: 27640 Da    PI: 4.9681
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo9G0038800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.22.8e-362982760
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                    +cprC+s+ntkfCyynnysl+qPryfCkaCrryWt+GGalrnvP+Gg++r++ +
  Spipo9G0038800 29 SCPRCESSNTKFCYYNNYSLAQPRYFCKACRRYWTEGGALRNVPIGGTTRRKSR 82
                    7***********************************************999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-221582IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.7822882IPR003851Zinc finger, Dof-type
PfamPF027012.1E-312981IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEPYSYFLHS PAPSMAERRW NPAVVWAPSC PRCESSNTKF CYYNNYSLAQ PRYFCKACRR  60
YWTEGGALRN VPIGGTTRRK SRPKPPAGRP HSSPPVRNEP PAAVSLPPVE CPSGGSDAPK  120
LAFTEVEFEV GRLLGRTNVG SYYQQMSTQM GQEQPPAGEE FPWPSPDVTA EETLLLDNLS  180
PFSVDSLGAM PPAEELAYEE VFWSGSPTVE GSCPWQRPQS LKTGATEEDQ PLPLPQLSPF  240
TMPSYEAFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.15e-32Dof family protein